PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A09G0579
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 240aa    MW: 28390.1 Da    PI: 9.0716
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A09G0579genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.41.8e-192269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll+++v+++G g+W+++ar  g++R +k+c++rw +yl
      Gh_A09G0579 22 KGPWTAEEDRLLIEYVRLHGEGRWNSVARLAGLKRNGKSCRLRWVNYL 69
                     79********************************************97 PP

2Myb_DNA-binding521.6e-1675119147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T+ E+ +++++++++G++ W+tIar ++ gRt++++k++w+++
      Gh_A09G0579  75 RGQITPHEESIILELHARWGNR-WSTIARSLP-GRTDNEIKNYWRTH 119
                      7888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.1531773IPR017930Myb domain
SuperFamilySSF466891.28E-3019116IPR009057Homeodomain-like
SMARTSM007173.9E-172171IPR001005SANT/Myb domain
PfamPF002495.2E-182269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-242376IPR009057Homeodomain-like
CDDcd001671.95E-112469No hitNo description
SMARTSM007171.4E-1474122IPR001005SANT/Myb domain
PROSITE profilePS5129419.3574124IPR017930Myb domain
PfamPF002499.4E-1475119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2477123IPR009057Homeodomain-like
CDDcd001673.71E-979120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MSWAMMGEQF GWGVIEEEGW RKGPWTAEED RLLIEYVRLH GEGRWNSVAR LAGLKRNGKS  60
CRLRWVNYLR PDLKRGQITP HEESIILELH ARWGNRWSTI ARSLPGRTDN EIKNYWRTHF  120
KKKAKLSPEN SDQAKARTLK RQHFQQQLLQ QKQQQQYLQL NESDMKRMMS LLEETEAKAQ  180
YMPQLRQEMG AATSCPNMAE EQSLFYPMGN GNETSNEDVV WDGLWNLDDY QWKLWCSKPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-272212427128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012483223.11e-161PREDICTED: transcription factor MYB21-like
SwissprotP813916e-54MYB05_ANTMA; Myb-related protein 305
TrEMBLA0A0D2RRS71e-161A0A0D2RRS7_G
STRINGPOPTR_0008s17350.11e-112(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31072766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.16e-84myb domain protein 305